Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,484
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,511
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,255
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,244
  1. Avatar for zxspectrum 11. zxspectrum Lv 1 54 pts. 10,532
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 51 pts. 10,524
  3. Avatar for grogar7 13. grogar7 Lv 1 47 pts. 10,520
  4. Avatar for Galaxie 14. Galaxie Lv 1 44 pts. 10,511
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 41 pts. 10,496
  6. Avatar for gmn 16. gmn Lv 1 38 pts. 10,483
  7. Avatar for jausmh 17. jausmh Lv 1 36 pts. 10,465
  8. Avatar for Joanna_H 18. Joanna_H Lv 1 33 pts. 10,432
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 31 pts. 10,370
  10. Avatar for christioanchauvin 20. christioanchauvin Lv 1 29 pts. 10,369

Comments