Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,484
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,511
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,255
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,244
  1. Avatar for TheGUmmer 21. TheGUmmer Lv 1 27 pts. 10,330
  2. Avatar for BootsMcGraw 22. BootsMcGraw Lv 1 25 pts. 10,325
  3. Avatar for Tehnologik1 23. Tehnologik1 Lv 1 23 pts. 10,305
  4. Avatar for alcor29 24. alcor29 Lv 1 21 pts. 10,261
  5. Avatar for g_b 25. g_b Lv 1 20 pts. 10,250
  6. Avatar for NinjaGreg 26. NinjaGreg Lv 1 18 pts. 10,248
  7. Avatar for Dr.Sillem 27. Dr.Sillem Lv 1 17 pts. 10,215
  8. Avatar for vs 28. vs Lv 1 15 pts. 10,196
  9. Avatar for meatexplosion 29. meatexplosion Lv 1 14 pts. 10,184
  10. Avatar for vybi 30. vybi Lv 1 13 pts. 10,148

Comments