Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,484
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,511
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,255
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,244
  1. Avatar for JuliaBCollet 31. JuliaBCollet Lv 1 12 pts. 10,139
  2. Avatar for nicobul 32. nicobul Lv 1 11 pts. 10,137
  3. Avatar for drumpeter18yrs9yrs 33. drumpeter18yrs9yrs Lv 1 10 pts. 10,117
  4. Avatar for jamiexq 34. jamiexq Lv 1 9 pts. 10,103
  5. Avatar for LHOr 35. LHOr Lv 1 8 pts. 10,099
  6. Avatar for heather-1 36. heather-1 Lv 1 8 pts. 10,055
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 7 pts. 10,037
  8. Avatar for BarrySampson 38. BarrySampson Lv 1 6 pts. 10,032
  9. Avatar for ludus9 39. ludus9 Lv 1 6 pts. 10,019
  10. Avatar for Apothecary1815 40. Apothecary1815 Lv 1 5 pts. 9,843

Comments