Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,484
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,511
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,255
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,244

  1. Avatar for Merf 51. Merf Lv 1 2 pts. 9,457
  2. Avatar for Tian00 52. Tian00 Lv 1 2 pts. 9,408
  3. Avatar for Osiris 53. Osiris Lv 1 1 pt. 9,404
  4. Avatar for Crossed Sticks 54. Crossed Sticks Lv 1 1 pt. 9,309
  5. Avatar for Trajan464 55. Trajan464 Lv 1 1 pt. 9,254
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 9,226
  7. Avatar for ProfVince 57. ProfVince Lv 1 1 pt. 9,088
  8. Avatar for nancy_naniewoo 58. nancy_naniewoo Lv 1 1 pt. 9,073
  9. Avatar for rinze 59. rinze Lv 1 1 pt. 8,968
  10. Avatar for zbp 60. zbp Lv 1 1 pt. 8,784

Comments