Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,484
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,511
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,255
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,244
  1. Avatar for RWoodcock 61. RWoodcock Lv 1 1 pt. 8,746
  2. Avatar for DScott 62. DScott Lv 1 1 pt. 8,700
  3. Avatar for Larini 63. Larini Lv 1 1 pt. 8,657
  4. Avatar for Savas 64. Savas Lv 1 1 pt. 8,511
  5. Avatar for Hellcat6 65. Hellcat6 Lv 1 1 pt. 8,415
  6. Avatar for mengzach 66. mengzach Lv 1 1 pt. 8,386
  7. Avatar for antibot215 67. antibot215 Lv 1 1 pt. 8,246
  8. Avatar for Jenot96 68. Jenot96 Lv 1 1 pt. 8,138
  9. Avatar for froschi2 69. froschi2 Lv 1 1 pt. 8,107
  10. Avatar for futsall 70. futsall Lv 1 1 pt. 8,033

Comments