Icon representing a puzzle

2612: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 21, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 9,484
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,511
  3. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 7,255
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 7,244

  1. Avatar for Jomeo 71. Jomeo Lv 1 1 pt. 7,876
  2. Avatar for itomato 72. itomato Lv 1 1 pt. 7,696
  3. Avatar for Partial 73. Partial Lv 1 1 pt. 7,649
  4. Avatar for furi0us 74. furi0us Lv 1 1 pt. 7,262
  5. Avatar for andrewgood 75. andrewgood Lv 1 1 pt. 7,255
  6. Avatar for Sammy3c2b1a0 76. Sammy3c2b1a0 Lv 1 1 pt. 7,244
  7. Avatar for deathbat_87 77. deathbat_87 Lv 1 1 pt. 7,148
  8. Avatar for Kurrabutt 78. Kurrabutt Lv 1 1 pt. 6,304
  9. Avatar for Toastering 79. Toastering Lv 1 1 pt. 5,370
  10. Avatar for ailiensafar 80. ailiensafar Lv 1 1 pt. 0

Comments