Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 9,174
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,786
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 8,679

  1. Avatar for georg137 21. georg137 Lv 1 27 pts. 10,304
  2. Avatar for Galaxie 22. Galaxie Lv 1 25 pts. 10,302
  3. Avatar for nicobul 23. nicobul Lv 1 23 pts. 10,299
  4. Avatar for alcor29 24. alcor29 Lv 1 21 pts. 10,288
  5. Avatar for hookedwarm 25. hookedwarm Lv 1 20 pts. 10,262
  6. Avatar for gmn 26. gmn Lv 1 18 pts. 10,253
  7. Avatar for zxspectrum 27. zxspectrum Lv 1 17 pts. 10,253
  8. Avatar for Aubade01 28. Aubade01 Lv 1 15 pts. 10,211
  9. Avatar for TheGUmmer 29. TheGUmmer Lv 1 14 pts. 10,183
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 13 pts. 10,150

Comments