Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 9 months ago

Novice Overall Prediction

Summary

Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,756
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 10,676
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,670
  4. Avatar for VeFold 4. VeFold 24 pts. 10,485
  5. Avatar for Contenders 5. Contenders 14 pts. 10,456
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,341
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,333
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,183
  9. Avatar for Australia 9. Australia 1 pt. 9,965
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,956
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,753
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 95 pts. 10,673
  3. Avatar for LociOiling 3. LociOiling Lv 1 89 pts. 10,670
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 84 pts. 10,654
  5. Avatar for meatexplosion 5. meatexplosion Lv 1 79 pts. 10,600
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 74 pts. 10,595
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 70 pts. 10,589
  8. Avatar for grogar7 8. grogar7 Lv 1 66 pts. 10,560
  9. Avatar for vs 9. vs Lv 1 62 pts. 10,494
  10. Avatar for BarrySampson 10. BarrySampson Lv 1 58 pts. 10,485

Comments