Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 9,174
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,786
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 8,679
  1. Avatar for ProfVince 41. ProfVince Lv 1 5 pts. 9,754
  2. Avatar for heather-1 42. heather-1 Lv 1 4 pts. 9,648
  3. Avatar for Dr.Sillem 43. Dr.Sillem Lv 1 4 pts. 9,401
  4. Avatar for Crossed Sticks 44. Crossed Sticks Lv 1 3 pts. 9,307
  5. Avatar for Tehnologik1 45. Tehnologik1 Lv 1 3 pts. 9,189
  6. Avatar for yabuzhan 46. yabuzhan Lv 1 3 pts. 9,174
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 3 pts. 9,121
  8. Avatar for Apothecary1815 48. Apothecary1815 Lv 1 2 pts. 9,075
  9. Avatar for Superphosphate 49. Superphosphate Lv 1 2 pts. 8,995
  10. Avatar for carxo 50. carxo Lv 1 2 pts. 8,961

Comments