Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 9,174
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,786
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 8,679

  1. Avatar for pizpot 51. pizpot Lv 1 2 pts. 8,929
  2. Avatar for Osiris 52. Osiris Lv 1 2 pts. 8,925
  3. Avatar for hansvandenhof 53. hansvandenhof Lv 1 1 pt. 8,909
  4. Avatar for hada 54. hada Lv 1 1 pt. 8,873
  5. Avatar for Savas 55. Savas Lv 1 1 pt. 8,786
  6. Avatar for zanbato 56. zanbato Lv 1 1 pt. 8,679
  7. Avatar for RWoodcock 57. RWoodcock Lv 1 1 pt. 8,568
  8. Avatar for haleyg 58. haleyg Lv 1 1 pt. 8,460
  9. Avatar for Larini 59. Larini Lv 1 1 pt. 8,413
  10. Avatar for ucad 60. ucad Lv 1 1 pt. 8,405

Comments