Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for METU-BIN 11. METU-BIN 1 pt. 9,174
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,786
  3. Avatar for Extraterrestrials 2.0 13. Extraterrestrials 2.0 1 pt. 8,679
  1. Avatar for lm25 81. lm25 Lv 1 1 pt. 6,744
  2. Avatar for miggless 82. miggless Lv 1 1 pt. 6,735
  3. Avatar for apetrides 83. apetrides Lv 1 1 pt. 6,049
  4. Avatar for Uma21308 84. Uma21308 Lv 1 1 pt. 4,583
  5. Avatar for ZeroLeak7 85. ZeroLeak7 Lv 1 1 pt. 2,801
  6. Avatar for ArthurFerrao 86. ArthurFerrao Lv 1 1 pt. 2,801

Comments