Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 9 months ago

Novice Overall Prediction

Summary

Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,756
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 10,676
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,670
  4. Avatar for VeFold 4. VeFold 24 pts. 10,485
  5. Avatar for Contenders 5. Contenders 14 pts. 10,456
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,341
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,333
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,183
  9. Avatar for Australia 9. Australia 1 pt. 9,965
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,956
  1. Avatar for Bruno Kestemont
    1. Bruno Kestemont Lv 1
    100 pts. 10,756
  2. Avatar for toshiue 2. toshiue Lv 1 56 pts. 10,755
  3. Avatar for bravosk8erboy 3. bravosk8erboy Lv 1 29 pts. 10,755
  4. Avatar for Apothecary1815 4. Apothecary1815 Lv 1 14 pts. 10,676
  5. Avatar for LociOiling 5. LociOiling Lv 1 6 pts. 10,669
  6. Avatar for Galaxie 6. Galaxie Lv 1 2 pts. 10,663
  7. Avatar for SemperRabbit 7. SemperRabbit Lv 1 1 pt. 10,651
  8. Avatar for alcor29 8. alcor29 Lv 1 1 pt. 10,631
  9. Avatar for vybi 9. vybi Lv 1 1 pt. 10,456
  10. Avatar for Anfinsen_slept_here 10. Anfinsen_slept_here Lv 1 1 pt. 10,443

Comments