Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,756
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 10,676
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,670
  4. Avatar for VeFold 4. VeFold 24 pts. 10,485
  5. Avatar for Contenders 5. Contenders 14 pts. 10,456
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,341
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,333
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,183
  9. Avatar for Australia 9. Australia 1 pt. 9,965
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,956

  1. Avatar for manu8170 31. manu8170 Lv 1 12 pts. 10,146
  2. Avatar for drumpeter18yrs9yrs 32. drumpeter18yrs9yrs Lv 1 11 pts. 10,131
  3. Avatar for AlkiP0Ps 33. AlkiP0Ps Lv 1 10 pts. 9,965
  4. Avatar for orily1337 34. orily1337 Lv 1 9 pts. 9,956
  5. Avatar for toshiue 35. toshiue Lv 1 8 pts. 9,956
  6. Avatar for badgoes 36. badgoes Lv 1 8 pts. 9,939
  7. Avatar for Vinara 37. Vinara Lv 1 7 pts. 9,844
  8. Avatar for pfirth 38. pfirth Lv 1 6 pts. 9,833
  9. Avatar for vybi 39. vybi Lv 1 6 pts. 9,777
  10. Avatar for jamiexq 40. jamiexq Lv 1 5 pts. 9,765

Comments