Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,756
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 10,676
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,670
  4. Avatar for VeFold 4. VeFold 24 pts. 10,485
  5. Avatar for Contenders 5. Contenders 14 pts. 10,456
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,341
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,333
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,183
  9. Avatar for Australia 9. Australia 1 pt. 9,965
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,956

  1. Avatar for Trajan464 61. Trajan464 Lv 1 1 pt. 8,370
  2. Avatar for BlueCat74 62. BlueCat74 Lv 1 1 pt. 8,298
  3. Avatar for DScott 63. DScott Lv 1 1 pt. 8,266
  4. Avatar for Merf 64. Merf Lv 1 1 pt. 8,259
  5. Avatar for Mohoernchen 65. Mohoernchen Lv 1 1 pt. 8,150
  6. Avatar for AlphaFold2 66. AlphaFold2 Lv 1 1 pt. 8,054
  7. Avatar for zbp 67. zbp Lv 1 1 pt. 7,999
  8. Avatar for Tian00 68. Tian00 Lv 1 1 pt. 7,951
  9. Avatar for nancy_naniewoo 69. nancy_naniewoo Lv 1 1 pt. 7,768
  10. Avatar for mengzach 70. mengzach Lv 1 1 pt. 7,668

Comments