Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,756
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 10,676
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,670
  4. Avatar for VeFold 4. VeFold 24 pts. 10,485
  5. Avatar for Contenders 5. Contenders 14 pts. 10,456
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,341
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,333
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,183
  9. Avatar for Australia 9. Australia 1 pt. 9,965
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,956

  1. Avatar for rinze 71. rinze Lv 1 1 pt. 7,548
  2. Avatar for MatMcLovin 72. MatMcLovin Lv 1 1 pt. 7,344
  3. Avatar for rezaefar 73. rezaefar Lv 1 1 pt. 7,236
  4. Avatar for squircle 74. squircle Lv 1 1 pt. 7,136
  5. Avatar for thewholeblahthing 75. thewholeblahthing Lv 1 1 pt. 7,125
  6. Avatar for Fasodankfds 76. Fasodankfds Lv 1 1 pt. 6,973
  7. Avatar for MSP_Jim 77. MSP_Jim Lv 1 1 pt. 6,860
  8. Avatar for lilmathew 78. lilmathew Lv 1 1 pt. 6,848
  9. Avatar for harvardman 79. harvardman Lv 1 1 pt. 6,785
  10. Avatar for furi0us 80. furi0us Lv 1 1 pt. 6,745

Comments