Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 10 months ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,756
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 10,676
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,670
  4. Avatar for VeFold 4. VeFold 24 pts. 10,485
  5. Avatar for Contenders 5. Contenders 14 pts. 10,456
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,341
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,333
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,183
  9. Avatar for Australia 9. Australia 1 pt. 9,965
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,956

  1. Avatar for lm25 81. lm25 Lv 1 1 pt. 6,744
  2. Avatar for miggless 82. miggless Lv 1 1 pt. 6,735
  3. Avatar for apetrides 83. apetrides Lv 1 1 pt. 6,049
  4. Avatar for Uma21308 84. Uma21308 Lv 1 1 pt. 4,583
  5. Avatar for ZeroLeak7 85. ZeroLeak7 Lv 1 1 pt. 2,801
  6. Avatar for ArthurFerrao 86. ArthurFerrao Lv 1 1 pt. 2,801

Comments