Icon representing a puzzle

2615: Revisiting Puzzle 134: Rice

Closed since 12 months ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 28, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups


  1. Avatar for Go Science 100 pts. 10,756
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 10,676
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 10,670
  4. Avatar for VeFold 4. VeFold 24 pts. 10,485
  5. Avatar for Contenders 5. Contenders 14 pts. 10,456
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,341
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 10,333
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 10,183
  9. Avatar for Australia 9. Australia 1 pt. 9,965
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,956

  1. Avatar for SemperRabbit 11. SemperRabbit Lv 1 54 pts. 10,466
  2. Avatar for dcrwheeler 12. dcrwheeler Lv 1 51 pts. 10,458
  3. Avatar for MicElephant 13. MicElephant Lv 1 47 pts. 10,456
  4. Avatar for akaaka 14. akaaka Lv 1 44 pts. 10,444
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 41 pts. 10,409
  6. Avatar for LHOr 16. LHOr Lv 1 38 pts. 10,361
  7. Avatar for g_b 17. g_b Lv 1 36 pts. 10,344
  8. Avatar for Joanna_H 18. Joanna_H Lv 1 33 pts. 10,341
  9. Avatar for WBarme1234 19. WBarme1234 Lv 1 31 pts. 10,333
  10. Avatar for Punzi Baker 3 20. Punzi Baker 3 Lv 1 29 pts. 10,308

Comments