Icon representing a puzzle

2618: Revisiting Puzzle 135: E. coli

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
June 04, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,915
  2. Avatar for Go Science 2. Go Science 60 pts. 9,875
  3. Avatar for Contenders 3. Contenders 33 pts. 9,723
  4. Avatar for Australia 4. Australia 17 pts. 9,702
  5. Avatar for VeFold 5. VeFold 8 pts. 9,613
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,537
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,477
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 9,454
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Team China 10. Team China 1 pt. 7,416

  1. Avatar for Punzi Baker 3 11. Punzi Baker 3 Lv 1 49 pts. 9,686
  2. Avatar for zxspectrum 12. zxspectrum Lv 1 46 pts. 9,683
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 42 pts. 9,651
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 39 pts. 9,648
  5. Avatar for akaaka 15. akaaka Lv 1 36 pts. 9,640
  6. Avatar for Dr.Sillem 16. Dr.Sillem Lv 1 33 pts. 9,613
  7. Avatar for g_b 17. g_b Lv 1 31 pts. 9,595
  8. Avatar for vs 18. vs Lv 1 28 pts. 9,568
  9. Avatar for meatexplosion 19. meatexplosion Lv 1 26 pts. 9,563
  10. Avatar for nicobul 20. nicobul Lv 1 24 pts. 9,537

Comments