Icon representing a puzzle

2618: Revisiting Puzzle 135: E. coli

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
June 04, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,915
  2. Avatar for Go Science 2. Go Science 60 pts. 9,875
  3. Avatar for Contenders 3. Contenders 33 pts. 9,723
  4. Avatar for Australia 4. Australia 17 pts. 9,702
  5. Avatar for VeFold 5. VeFold 8 pts. 9,613
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,537
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,477
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 9,454
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Team China 10. Team China 1 pt. 7,416

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,914
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 9,873
  3. Avatar for Serca 3. Serca Lv 1 88 pts. 9,796
  4. Avatar for gmn 4. gmn Lv 1 82 pts. 9,779
  5. Avatar for SemperRabbit 5. SemperRabbit Lv 1 77 pts. 9,761
  6. Avatar for grogar7 6. grogar7 Lv 1 71 pts. 9,737
  7. Avatar for BootsMcGraw 7. BootsMcGraw Lv 1 66 pts. 9,723
  8. Avatar for Galaxie 8. Galaxie Lv 1 62 pts. 9,706
  9. Avatar for AlkiP0Ps 9. AlkiP0Ps Lv 1 57 pts. 9,702
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 53 pts. 9,686

Comments