Icon representing a puzzle

2618: Revisiting Puzzle 135: E. coli

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
June 04, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,915
  2. Avatar for Go Science 2. Go Science 60 pts. 9,875
  3. Avatar for Contenders 3. Contenders 33 pts. 9,723
  4. Avatar for Australia 4. Australia 17 pts. 9,702
  5. Avatar for VeFold 5. VeFold 8 pts. 9,613
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,537
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,477
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 9,454
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Team China 10. Team China 1 pt. 7,416

  1. Avatar for MicElephant 21. MicElephant Lv 1 22 pts. 9,490
  2. Avatar for alcor29 22. alcor29 Lv 1 20 pts. 9,482
  3. Avatar for TheGUmmer 23. TheGUmmer Lv 1 18 pts. 9,477
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 17 pts. 9,459
  5. Avatar for drumpeter18yrs9yrs 25. drumpeter18yrs9yrs Lv 1 15 pts. 9,458
  6. Avatar for Joanna_H 26. Joanna_H Lv 1 14 pts. 9,454
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 12 pts. 9,431
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 11 pts. 9,421
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 10 pts. 9,386
  10. Avatar for heather-1 30. heather-1 Lv 1 9 pts. 9,353

Comments