Icon representing a puzzle

2618: Revisiting Puzzle 135: E. coli

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
June 04, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,915
  2. Avatar for Go Science 2. Go Science 60 pts. 9,875
  3. Avatar for Contenders 3. Contenders 33 pts. 9,723
  4. Avatar for Australia 4. Australia 17 pts. 9,702
  5. Avatar for VeFold 5. VeFold 8 pts. 9,613
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,537
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,477
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 9,454
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Team China 10. Team China 1 pt. 7,416

  1. Avatar for georg137 51. georg137 Lv 1 1 pt. 9,045
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 8,972
  3. Avatar for Crossed Sticks 53. Crossed Sticks Lv 1 1 pt. 8,926
  4. Avatar for Osiris 54. Osiris Lv 1 1 pt. 8,903
  5. Avatar for DScott 55. DScott Lv 1 1 pt. 8,799
  6. Avatar for RWoodcock 56. RWoodcock Lv 1 1 pt. 8,776
  7. Avatar for zbp 57. zbp Lv 1 1 pt. 8,714
  8. Avatar for brsp05 58. brsp05 Lv 1 1 pt. 8,602
  9. Avatar for Trajan464 59. Trajan464 Lv 1 1 pt. 8,558
  10. Avatar for JustinRothganger 60. JustinRothganger Lv 1 1 pt. 8,549

Comments