Icon representing a puzzle

2618: Revisiting Puzzle 135: E. coli

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
June 04, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,915
  2. Avatar for Go Science 2. Go Science 60 pts. 9,875
  3. Avatar for Contenders 3. Contenders 33 pts. 9,723
  4. Avatar for Australia 4. Australia 17 pts. 9,702
  5. Avatar for VeFold 5. VeFold 8 pts. 9,613
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,537
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,477
  8. Avatar for Gargleblasters 8. Gargleblasters 1 pt. 9,454
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,431
  10. Avatar for Team China 10. Team China 1 pt. 7,416

  1. Avatar for Baver 61. Baver Lv 1 1 pt. 8,413
  2. Avatar for Alistair69 62. Alistair69 Lv 1 1 pt. 8,302
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 8,003
  4. Avatar for DipsyDoodle2016 64. DipsyDoodle2016 Lv 1 1 pt. 7,984
  5. Avatar for Merf 65. Merf Lv 1 1 pt. 7,943
  6. Avatar for efull 66. efull Lv 1 1 pt. 7,852
  7. Avatar for cjddig 67. cjddig Lv 1 1 pt. 7,750
  8. Avatar for furi0us 68. furi0us Lv 1 1 pt. 7,485
  9. Avatar for zo3xiaJonWeinberg 69. zo3xiaJonWeinberg Lv 1 1 pt. 7,416
  10. Avatar for Tehnologik1 70. Tehnologik1 Lv 1 1 pt. 7,402

Comments