Placeholder image of a protein
Icon representing a puzzle

2624: Electron Density Reconstruction 123

Closed since 9 months ago

Novice Overall Prediction Electron Density

Summary

Created
June 11, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You might be wondering how this protein is stable- it's not the whole protein, just the part that was crystallized for solving, hence the strange shape. It's big, so the Trim tool is recommended.

Sequence
RTEQQAASLEQTAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEQSAAAAAALEEQASRLTEAVAVFRIQQQ

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 57,685
  2. Avatar for Go Science 2. Go Science 47 pts. 57,654
  3. Avatar for VeFold 3. VeFold 19 pts. 57,630
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 7 pts. 57,620
  5. Avatar for Contenders 5. Contenders 2 pts. 57,592
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 57,263
  7. Avatar for Australia 7. Australia 1 pt. 57,003
  8. Avatar for Team China 8. Team China 1 pt. 52,853
  1. Avatar for SileNTViP 31. SileNTViP Lv 1 4 pts. 56,382
  2. Avatar for drumpeter18yrs9yrs 32. drumpeter18yrs9yrs Lv 1 4 pts. 56,369
  3. Avatar for rosie4loop 33. rosie4loop Lv 1 3 pts. 56,121
  4. Avatar for georg137 34. georg137 Lv 1 3 pts. 56,007
  5. Avatar for Anfinsen_slept_here 35. Anfinsen_slept_here Lv 1 3 pts. 55,910
  6. Avatar for hada 36. hada Lv 1 2 pts. 55,828
  7. Avatar for 3poke 37. 3poke Lv 1 2 pts. 55,789
  8. Avatar for pfirth 38. pfirth Lv 1 2 pts. 55,725
  9. Avatar for Dr.Sillem 39. Dr.Sillem Lv 1 1 pt. 55,697
  10. Avatar for corvidcapsule 40. corvidcapsule Lv 1 1 pt. 55,644

Comments