Placeholder image of a protein
Icon representing a puzzle

2624: Electron Density Reconstruction 123

Closed since 9 months ago

Novice Overall Prediction Electron Density

Summary


Created
June 11, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You might be wondering how this protein is stable- it's not the whole protein, just the part that was crystallized for solving, hence the strange shape. It's big, so the Trim tool is recommended.

Sequence
RTEQQAASLEQTAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEQSAAAAAALEEQASRLTEAVAVFRIQQQ

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 57,685
  2. Avatar for Go Science 2. Go Science 47 pts. 57,654
  3. Avatar for VeFold 3. VeFold 19 pts. 57,630
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 7 pts. 57,620
  5. Avatar for Contenders 5. Contenders 2 pts. 57,592
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 57,263
  7. Avatar for Australia 7. Australia 1 pt. 57,003
  8. Avatar for Team China 8. Team China 1 pt. 52,853

  1. Avatar for carxo 51. carxo Lv 1 1 pt. 54,063
  2. Avatar for Jenot96 52. Jenot96 Lv 1 1 pt. 53,843
  3. Avatar for rinze 53. rinze Lv 1 1 pt. 53,604
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 53,561
  5. Avatar for Ardbegger 55. Ardbegger Lv 1 1 pt. 53,237
  6. Avatar for jdmclure 56. jdmclure Lv 1 1 pt. 52,899
  7. Avatar for lezhe 57. lezhe Lv 1 1 pt. 52,853
  8. Avatar for furi0us 58. furi0us Lv 1 1 pt. 52,134
  9. Avatar for mart0258 59. mart0258 Lv 1 1 pt. 51,946
  10. Avatar for Laudrup18 60. Laudrup18 Lv 1 1 pt. 49,818

Comments