Icon representing a puzzle

2623: Revisiting Puzzle 137: Rosetta Decoy

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
June 18, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Firesign 11. Firesign 1 pt. 9,640

  1. Avatar for georg137 21. georg137 Lv 1 21 pts. 11,389
  2. Avatar for meatexplosion 22. meatexplosion Lv 1 19 pts. 11,386
  3. Avatar for BarrySampson 23. BarrySampson Lv 1 17 pts. 11,363
  4. Avatar for BootsMcGraw 24. BootsMcGraw Lv 1 16 pts. 11,358
  5. Avatar for SemperRabbit 25. SemperRabbit Lv 1 14 pts. 11,293
  6. Avatar for toshiue 26. toshiue Lv 1 13 pts. 11,268
  7. Avatar for alcor29 27. alcor29 Lv 1 12 pts. 11,249
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 10 pts. 11,218
  9. Avatar for heather-1 29. heather-1 Lv 1 9 pts. 11,179
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 8 pts. 11,122

Comments