Icon representing a puzzle

2623: Revisiting Puzzle 137: Rosetta Decoy

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
June 18, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Firesign 11. Firesign 1 pt. 9,640

  1. Avatar for SileNTViP 51. SileNTViP Lv 1 1 pt. 10,827
  2. Avatar for Osiris 52. Osiris Lv 1 1 pt. 10,687
  3. Avatar for MicElephant 53. MicElephant Lv 1 1 pt. 10,681
  4. Avatar for 3poke 54. 3poke Lv 1 1 pt. 10,624
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 10,477
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 10,450
  7. Avatar for Opelgang 57. Opelgang Lv 1 1 pt. 10,379
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 10,377
  9. Avatar for Merf 59. Merf Lv 1 1 pt. 10,365
  10. Avatar for Jenot96 60. Jenot96 Lv 1 1 pt. 10,332

Comments