Icon representing a puzzle

2623: Revisiting Puzzle 137: Rosetta Decoy

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
June 18, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups

  1. Avatar for Firesign 11. Firesign 1 pt. 9,640
  1. Avatar for Ardbegger 71. Ardbegger Lv 1 1 pt. 8,540
  2. Avatar for LangeNacht6 72. LangeNacht6 Lv 1 1 pt. 8,438
  3. Avatar for paug14 73. paug14 Lv 1 1 pt. 8,438
  4. Avatar for Rocky Roccoco 74. Rocky Roccoco Lv 1 1 pt. 8,438

Comments