Icon representing a puzzle

2623: Revisiting Puzzle 137: Rosetta Decoy

Closed since 9 months ago

Novice Overall Prediction

Summary


Created
June 18, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,075
  2. Avatar for Go Science 2. Go Science 60 pts. 11,793
  3. Avatar for Australia 3. Australia 33 pts. 11,563
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 11,544
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 11,540
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 11,511
  7. Avatar for Contenders 7. Contenders 2 pts. 11,429
  8. Avatar for VeFold 8. VeFold 1 pt. 11,363
  9. Avatar for Team China 9. Team China 1 pt. 10,097
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 9,869

  1. Avatar for WBarme1234 11. WBarme1234 Lv 1 48 pts. 11,540
  2. Avatar for grogar7 12. grogar7 Lv 1 45 pts. 11,537
  3. Avatar for vs 13. vs Lv 1 41 pts. 11,526
  4. Avatar for christioanchauvin 14. christioanchauvin Lv 1 38 pts. 11,511
  5. Avatar for Galaxie 15. Galaxie Lv 1 35 pts. 11,482
  6. Avatar for NinjaGreg 16. NinjaGreg Lv 1 32 pts. 11,455
  7. Avatar for nicobul 17. nicobul Lv 1 30 pts. 11,447
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 27 pts. 11,429
  9. Avatar for Punzi Baker 3 19. Punzi Baker 3 Lv 1 25 pts. 11,408
  10. Avatar for zxspectrum 20. zxspectrum Lv 1 23 pts. 11,405

Comments