2623: Revisiting Puzzle 137: Rosetta Decoy
Closed since 9 months ago
Novice Overall PredictionSummary
- Created
- June 18, 2025
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
- Sequence
- YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE
Top groups
-
100 pts. 12,075
-
-
-
-
-
-
-
-
-
Comments