Placeholder image of a protein
Icon representing a puzzle

2633: Electron Density Reconstruction 126

Closed since 8 months ago

Novice Overall Prediction Electron Density

Summary


Created
July 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is related to the one given previously in 2631, so many facets will look similar. There's three separate protein chains here, one really big one and two smaller, so the Trim tool is recommended.

Sequence
MKKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKLLNK MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILKPPTTPRV MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRFL

Top groups


  1. Avatar for Bioqué? 11. Bioqué? 1 pt. 41,928

  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 39 pts. 52,000
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 35 pts. 51,621
  3. Avatar for g_b 13. g_b Lv 1 32 pts. 51,591
  4. Avatar for toshiue 14. toshiue Lv 1 29 pts. 51,568
  5. Avatar for Galaxie 15. Galaxie Lv 1 26 pts. 51,555
  6. Avatar for grogar7 16. grogar7 Lv 1 23 pts. 51,461
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 20 pts. 51,302
  8. Avatar for nicobul 18. nicobul Lv 1 18 pts. 51,021
  9. Avatar for SemperRabbit 19. SemperRabbit Lv 1 16 pts. 50,995
  10. Avatar for alcor29 20. alcor29 Lv 1 14 pts. 50,744

Comments


LociOiling Lv 1

It looks like this week's puzzle is PDB 1RHZ. It's basically the same as last week's puzzle, but without the missing residue gap in chain A.

PDB 1RH5 is the version with 12 missing residues in chain A, and it appeared in last week's Puzzle 2630.