Placeholder image of a protein
Icon representing a puzzle

2633: Electron Density Reconstruction 126

Closed since 9 months ago

Novice Overall Prediction Electron Density

Summary

Created
July 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is related to the one given previously in 2631, so many facets will look similar. There's three separate protein chains here, one really big one and two smaller, so the Trim tool is recommended.

Sequence
MKKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKLLNK MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILKPPTTPRV MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRFL

Top groups

  1. Avatar for Bioqué? 11. Bioqué? 1 pt. 41,928
  1. Avatar for meatexplosion 21. meatexplosion Lv 1 13 pts. 50,736
  2. Avatar for TheGUmmer 22. TheGUmmer Lv 1 11 pts. 50,571
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 10 pts. 50,430
  4. Avatar for BootsMcGraw 24. BootsMcGraw Lv 1 9 pts. 50,238
  5. Avatar for jausmh 25. jausmh Lv 1 7 pts. 50,184
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 6 pts. 49,563
  7. Avatar for vs 27. vs Lv 1 6 pts. 49,526
  8. Avatar for MicElephant 28. MicElephant Lv 1 5 pts. 49,501
  9. Avatar for zxspectrum 29. zxspectrum Lv 1 4 pts. 49,422
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 4 pts. 49,150

Comments

LociOiling Lv 1

It looks like this week's puzzle is PDB 1RHZ. It's basically the same as last week's puzzle, but without the missing residue gap in chain A.

PDB 1RH5 is the version with 12 missing residues in chain A, and it appeared in last week's Puzzle 2630.