Placeholder image of a protein
Icon representing a puzzle

2633: Electron Density Reconstruction 126

Closed since 8 months ago

Novice Overall Prediction Electron Density

Summary

Created
July 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is related to the one given previously in 2631, so many facets will look similar. There's three separate protein chains here, one really big one and two smaller, so the Trim tool is recommended.

Sequence
MKKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKLLNK MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILKPPTTPRV MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRFL

Top groups

  1. Avatar for Bioqué? 11. Bioqué? 1 pt. 41,928
  1. Avatar for Larini 41. Larini Lv 1 1 pt. 46,735
  2. Avatar for Merf 42. Merf Lv 1 1 pt. 46,574
  3. Avatar for pfirth 43. pfirth Lv 1 1 pt. 46,156
  4. Avatar for orily1337 44. orily1337 Lv 1 1 pt. 45,880
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 45,564
  6. Avatar for hansvandenhof 46. hansvandenhof Lv 1 1 pt. 45,343
  7. Avatar for Jenot96 47. Jenot96 Lv 1 1 pt. 45,185
  8. Avatar for drumpeter18yrs9yrs 48. drumpeter18yrs9yrs Lv 1 1 pt. 45,166
  9. Avatar for RWoodcock 49. RWoodcock Lv 1 1 pt. 45,148
  10. Avatar for zo3xiaJonWeinberg 50. zo3xiaJonWeinberg Lv 1 1 pt. 45,094

Comments

LociOiling Lv 1

It looks like this week's puzzle is PDB 1RHZ. It's basically the same as last week's puzzle, but without the missing residue gap in chain A.

PDB 1RH5 is the version with 12 missing residues in chain A, and it appeared in last week's Puzzle 2630.