Placeholder image of a protein
Icon representing a puzzle

2633: Electron Density Reconstruction 126

Closed since 8 months ago

Novice Overall Prediction Electron Density

Summary

Created
July 02, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle is related to the one given previously in 2631, so many facets will look similar. There's three separate protein chains here, one really big one and two smaller, so the Trim tool is recommended.

Sequence
MKKLIPILEKIPEVELPVKEITFKEKLKWTGIVLVLYFIMGCIDVYTAGAQIPAIFEFWQTITASRIGTLITLGIGPIVTAGIIMQLLVGSGIIQMDLSIPENRALFQGCQKLLSIIMCFVEAVLFVGAGAFGILTPLLAFLVIIQIAFGSIILIYLDEIVSKYGIGSGIGLFIAAGVSQTIFVGALGPEGYLWKFLNSLIQGVPNIEYIAPIIGTIIVFLMVVYAECMRVEIPLAHGRIKGAVGKYPIKFVYVSNIPVILAAALFANIQLWGLALYRMGIPILGHYEGGRAVDGIAYYLSTPYGLSSVISDPIHAIVYMIAMIITCVMFGIFWVETTGLDPKSMAKRIGSLGMAIKGFRKSEKAIEHRLKRYIPPLTVMSSAFVGFLATIANFIGALGGGTGVLLTVSIVYRMYEQLLREKVSELHPAIAKLLNK MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILKPPTTPRV MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRFL

Top groups

  1. Avatar for Bioqué? 11. Bioqué? 1 pt. 41,928
  1. Avatar for carxo 51. carxo Lv 1 1 pt. 44,810
  2. Avatar for eimenotsu 52. eimenotsu Lv 1 1 pt. 44,304
  3. Avatar for rinze 53. rinze Lv 1 1 pt. 43,170
  4. Avatar for efull 54. efull Lv 1 1 pt. 42,040
  5. Avatar for Neckot 55. Neckot Lv 1 1 pt. 41,928
  6. Avatar for furi0us 56. furi0us Lv 1 1 pt. 40,559
  7. Avatar for thewholeblahthing 57. thewholeblahthing Lv 1 1 pt. 40,522
  8. Avatar for zbp 58. zbp Lv 1 1 pt. 37,701
  9. Avatar for SileNTViP 59. SileNTViP Lv 1 1 pt. 28,880

Comments

LociOiling Lv 1

It looks like this week's puzzle is PDB 1RHZ. It's basically the same as last week's puzzle, but without the missing residue gap in chain A.

PDB 1RH5 is the version with 12 missing residues in chain A, and it appeared in last week's Puzzle 2630.