Icon representing a puzzle

2635: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since 9 months ago

Novice Overall Prediction

Summary


Created
July 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 10,870
  2. Avatar for Firesign 12. Firesign 1 pt. 8,561

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,019
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 93 pts. 11,857
  3. Avatar for Galaxie 3. Galaxie Lv 1 86 pts. 11,831
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 80 pts. 11,815
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 74 pts. 11,786
  6. Avatar for grogar7 6. grogar7 Lv 1 68 pts. 11,782
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 63 pts. 11,716
  8. Avatar for akaaka 8. akaaka Lv 1 58 pts. 11,707
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 53 pts. 11,701
  10. Avatar for georg137 10. georg137 Lv 1 49 pts. 11,700

Comments