Icon representing a puzzle

2635: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,040
  2. Avatar for Go Science 2. Go Science 63 pts. 11,897
  3. Avatar for Contenders 3. Contenders 37 pts. 11,700
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,691
  5. Avatar for VeFold 5. VeFold 11 pts. 11,638
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 11,596
  7. Avatar for Australia 7. Australia 2 pts. 11,588
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,441
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 11,353
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 11,112
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 12,019
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 93 pts. 11,857
  3. Avatar for Galaxie 3. Galaxie Lv 1 86 pts. 11,831
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 80 pts. 11,815
  5. Avatar for dcrwheeler 5. dcrwheeler Lv 1 74 pts. 11,786
  6. Avatar for grogar7 6. grogar7 Lv 1 68 pts. 11,782
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 63 pts. 11,716
  8. Avatar for akaaka 8. akaaka Lv 1 58 pts. 11,707
  9. Avatar for Dr. Goochie 9. Dr. Goochie Lv 1 53 pts. 11,701
  10. Avatar for georg137 10. georg137 Lv 1 49 pts. 11,700

Comments