Icon representing a puzzle

2635: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since 9 months ago

Novice Overall Prediction

Summary

Created
July 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 10,870
  2. Avatar for Firesign 12. Firesign 1 pt. 8,561
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 17 pts. 11,506
  2. Avatar for Aubade01 22. Aubade01 Lv 1 15 pts. 11,480
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 14 pts. 11,456
  4. Avatar for TheGUmmer 24. TheGUmmer Lv 1 12 pts. 11,441
  5. Avatar for vs 25. vs Lv 1 11 pts. 11,420
  6. Avatar for Idiotboy 26. Idiotboy Lv 1 10 pts. 11,354
  7. Avatar for WBarme1234 27. WBarme1234 Lv 1 9 pts. 11,353
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 8 pts. 11,333
  9. Avatar for alcor29 29. alcor29 Lv 1 7 pts. 11,323
  10. Avatar for heather-1 30. heather-1 Lv 1 6 pts. 11,317

Comments