Icon representing a puzzle

2635: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 10,870
  2. Avatar for Firesign 12. Firesign 1 pt. 8,561
  1. Avatar for hada 41. hada Lv 1 1 pt. 10,890
  2. Avatar for abiogenesis 42. abiogenesis Lv 1 1 pt. 10,872
  3. Avatar for Joanna_H 43. Joanna_H Lv 1 1 pt. 10,870
  4. Avatar for pfirth 44. pfirth Lv 1 1 pt. 10,736
  5. Avatar for muffnerk 45. muffnerk Lv 1 1 pt. 10,669
  6. Avatar for SWR_DMaster 46. SWR_DMaster Lv 1 1 pt. 10,641
  7. Avatar for Larini 47. Larini Lv 1 1 pt. 10,585
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 10,571
  9. Avatar for Trajan464 49. Trajan464 Lv 1 1 pt. 10,494
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 10,219

Comments