Icon representing a puzzle

2635: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 10,870
  2. Avatar for Firesign 12. Firesign 1 pt. 8,561
  1. Avatar for bio_gamer1234 61. bio_gamer1234 Lv 1 1 pt. 9,206
  2. Avatar for Rocky Roccoco 62. Rocky Roccoco Lv 1 1 pt. 8,738
  3. Avatar for Betty Jo Bialosky 63. Betty Jo Bialosky Lv 1 1 pt. 8,561
  4. Avatar for beta_helix 64. beta_helix Lv 1 1 pt. 8,561
  5. Avatar for NickDanger 65. NickDanger Lv 1 1 pt. 8,561
  6. Avatar for skatp 66. skatp Lv 1 1 pt. 8,561
  7. Avatar for spvincent 67. spvincent Lv 1 1 pt. 8,561

Comments