Icon representing a puzzle

2635: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since 9 months ago

Novice Overall Prediction

Summary


Created
July 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,040
  2. Avatar for Go Science 2. Go Science 63 pts. 11,897
  3. Avatar for Contenders 3. Contenders 37 pts. 11,700
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,691
  5. Avatar for VeFold 5. VeFold 11 pts. 11,638
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 11,596
  7. Avatar for Australia 7. Australia 2 pts. 11,588
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,441
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 11,353
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 11,112

  1. Avatar for zxspectrum 31. zxspectrum Lv 1 5 pts. 11,287
  2. Avatar for LHOr 32. LHOr Lv 1 5 pts. 11,278
  3. Avatar for vybi 33. vybi Lv 1 4 pts. 11,150
  4. Avatar for Dr.Sillem 34. Dr.Sillem Lv 1 4 pts. 11,143
  5. Avatar for SileNTViP 35. SileNTViP Lv 1 3 pts. 11,129
  6. Avatar for vuvuvu 36. vuvuvu Lv 1 3 pts. 11,112
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 2 pts. 11,081
  8. Avatar for ppp6 38. ppp6 Lv 1 2 pts. 10,958
  9. Avatar for montezumasrevenge 39. montezumasrevenge Lv 1 2 pts. 10,954
  10. Avatar for jamiexq 40. jamiexq Lv 1 2 pts. 10,938

Comments