Icon representing a puzzle

2635: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since 10 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,040
  2. Avatar for Go Science 2. Go Science 63 pts. 11,897
  3. Avatar for Contenders 3. Contenders 37 pts. 11,700
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,691
  5. Avatar for VeFold 5. VeFold 11 pts. 11,638
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 11,596
  7. Avatar for Australia 7. Australia 2 pts. 11,588
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,441
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 11,353
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 11,112

  1. Avatar for nicobul 11. nicobul Lv 1 44 pts. 11,691
  2. Avatar for gmn 12. gmn Lv 1 41 pts. 11,665
  3. Avatar for MicElephant 13. MicElephant Lv 1 37 pts. 11,660
  4. Avatar for hookedwarm 14. hookedwarm Lv 1 34 pts. 11,638
  5. Avatar for g_b 15. g_b Lv 1 31 pts. 11,628
  6. Avatar for orily1337 16. orily1337 Lv 1 28 pts. 11,596
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 25 pts. 11,588
  8. Avatar for Tehnologik1 18. Tehnologik1 Lv 1 23 pts. 11,586
  9. Avatar for SemperRabbit 19. SemperRabbit Lv 1 21 pts. 11,585
  10. Avatar for meatexplosion 20. meatexplosion Lv 1 19 pts. 11,509

Comments