Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups


  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,771
  2. Avatar for Bioqué? 12. Bioqué? 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,483
  4. Avatar for Firesign 14. Firesign 1 pt. 9,348

  1. Avatar for wosser1 61. wosser1 Lv 1 1 pt. 10,766
  2. Avatar for efull 62. efull Lv 1 1 pt. 10,725
  3. Avatar for Neckot 63. Neckot Lv 1 1 pt. 10,706
  4. Avatar for Jenot96 64. Jenot96 Lv 1 1 pt. 10,694
  5. Avatar for helon 65. helon Lv 1 1 pt. 10,675
  6. Avatar for CAN1958 66. CAN1958 Lv 1 1 pt. 10,663
  7. Avatar for nagasan64 67. nagasan64 Lv 1 1 pt. 10,629
  8. Avatar for froschi2 68. froschi2 Lv 1 1 pt. 10,582
  9. Avatar for Nolv3rNT 69. Nolv3rNT Lv 1 1 pt. 10,553
  10. Avatar for furi0us 70. furi0us Lv 1 1 pt. 10,528

Comments