Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,182
  2. Avatar for Go Science 2. Go Science 68 pts. 12,167
  3. Avatar for Contenders 3. Contenders 44 pts. 12,044
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,984
  5. Avatar for Australia 5. Australia 16 pts. 11,952
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,865
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 11,823
  8. Avatar for VeFold 8. VeFold 3 pts. 11,800
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 11,790
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 11,404
  1. Avatar for wosser1 61. wosser1 Lv 1 1 pt. 10,766
  2. Avatar for efull 62. efull Lv 1 1 pt. 10,725
  3. Avatar for Neckot 63. Neckot Lv 1 1 pt. 10,706
  4. Avatar for Jenot96 64. Jenot96 Lv 1 1 pt. 10,694
  5. Avatar for helon 65. helon Lv 1 1 pt. 10,675
  6. Avatar for CAN1958 66. CAN1958 Lv 1 1 pt. 10,663
  7. Avatar for nagasan64 67. nagasan64 Lv 1 1 pt. 10,629
  8. Avatar for froschi2 68. froschi2 Lv 1 1 pt. 10,582
  9. Avatar for Nolv3rNT 69. Nolv3rNT Lv 1 1 pt. 10,553
  10. Avatar for furi0us 70. furi0us Lv 1 1 pt. 10,528

Comments