Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 10,771
  2. Avatar for Bioqué? 12. Bioqué? 1 pt. 10,706
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 10,483
  4. Avatar for Firesign 14. Firesign 1 pt. 9,348
  1. Avatar for RWoodcock 71. RWoodcock Lv 1 1 pt. 10,518
  2. Avatar for Sammy3c2b1a0 72. Sammy3c2b1a0 Lv 1 1 pt. 10,483
  3. Avatar for jiogenius 73. jiogenius Lv 1 1 pt. 10,406
  4. Avatar for ne0ekspert 74. ne0ekspert Lv 1 1 pt. 10,287
  5. Avatar for w1w1w 75. w1w1w Lv 1 1 pt. 10,051
  6. Avatar for apetrides 76. apetrides Lv 1 1 pt. 9,933
  7. Avatar for Johntaropopp 77. Johntaropopp Lv 1 1 pt. 9,463
  8. Avatar for CDMA 78. CDMA Lv 1 1 pt. 9,402
  9. Avatar for RegnadKcin 79. RegnadKcin Lv 1 1 pt. 9,348

Comments