Icon representing a puzzle

2638: Revisiting Puzzle 142: Rosetta Decoy 6

Closed since 8 months ago

Novice Overall Prediction

Summary

Created
July 23, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein was evolved in vitro to bind testosterone; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
AAPTATVTPSSGLSDGTVVKVAGAGLQAGTAYWVAQWARVDTGVWAYNPADNSSVTADANGSASTSLTVRRSFEGFLFDGTRWGTVDCTTAACQVGLSDAAGNGPEGVAISF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,182
  2. Avatar for Go Science 2. Go Science 68 pts. 12,167
  3. Avatar for Contenders 3. Contenders 44 pts. 12,044
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,984
  5. Avatar for Australia 5. Australia 16 pts. 11,952
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 11,865
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 11,823
  8. Avatar for VeFold 8. VeFold 3 pts. 11,800
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 11,790
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 11,404
  1. Avatar for RWoodcock 71. RWoodcock Lv 1 1 pt. 10,518
  2. Avatar for Sammy3c2b1a0 72. Sammy3c2b1a0 Lv 1 1 pt. 10,483
  3. Avatar for jiogenius 73. jiogenius Lv 1 1 pt. 10,406
  4. Avatar for ne0ekspert 74. ne0ekspert Lv 1 1 pt. 10,287
  5. Avatar for w1w1w 75. w1w1w Lv 1 1 pt. 10,051
  6. Avatar for apetrides 76. apetrides Lv 1 1 pt. 9,933
  7. Avatar for Johntaropopp 77. Johntaropopp Lv 1 1 pt. 9,463
  8. Avatar for CDMA 78. CDMA Lv 1 1 pt. 9,402
  9. Avatar for RegnadKcin 79. RegnadKcin Lv 1 1 pt. 9,348

Comments