Placeholder image of a protein
Icon representing a puzzle

2642: Electron Density Reconstruction 129

Closed since 7 months ago

Novice Overall Prediction Electron Density

Summary

Created
July 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMKNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTNVEEEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLSNPL MVNRIELSRLIGLLLETEKRKNTEQKESGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 42,359
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 42,308
  3. Avatar for Australia 3. Australia 29 pts. 42,118
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 42,011
  5. Avatar for Contenders 5. Contenders 6 pts. 41,943
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 41,858
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 41,664
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 41,611
  9. Avatar for VeFold 9. VeFold 1 pt. 41,406
  10. Avatar for Andrew's Foldit group 10. Andrew's Foldit group 1 pt. 39,314
  1. Avatar for akaaka 11. akaaka Lv 1 44 pts. 41,944
  2. Avatar for g_b 12. g_b Lv 1 41 pts. 41,926
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 37 pts. 41,904
  4. Avatar for gmn 14. gmn Lv 1 34 pts. 41,904
  5. Avatar for spvincent 15. spvincent Lv 1 31 pts. 41,903
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 28 pts. 41,858
  7. Avatar for nicobul 17. nicobul Lv 1 25 pts. 41,842
  8. Avatar for taiunplant 18. taiunplant Lv 1 23 pts. 41,693
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 21 pts. 41,693
  10. Avatar for jausmh 20. jausmh Lv 1 19 pts. 41,664

Comments