Placeholder image of a protein
Icon representing a puzzle

2642: Electron Density Reconstruction 129

Closed since 7 months ago

Novice Overall Prediction Electron Density

Summary

Created
July 23, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GSHMKNPYSNQIEREELILKYLPLVKAIATNIKKHLPEDVDIRDLISYGVIGLIKAVDNLSTENPKRAEAYIKLRIKGAIYDYLRSLDFGSRQVREKERRIKEVVEKLKEKLGREPTDEEVAKELGISTEELFKTLDKINFSYILSLEEVFRDFARDYSELIPSSTNVEEEVIKRELTEKVKEAVSKLPEREKLVIQLIFYEELPAKEVAKILETSVSRVSQLKAKALERLREMLSNPL MVNRIELSRLIGLLLETEKRKNTEQKESGTNKIEDKVTLSKIAQELSKNDVEEKDLEKKVKELKEKIEKGEYEVSDEKVVKGLIEFFT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 42,359
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 42,308
  3. Avatar for Australia 3. Australia 29 pts. 42,118
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 42,011
  5. Avatar for Contenders 5. Contenders 6 pts. 41,943
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 41,858
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 41,664
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 41,611
  9. Avatar for VeFold 9. VeFold 1 pt. 41,406
  10. Avatar for Andrew's Foldit group 10. Andrew's Foldit group 1 pt. 39,314
  1. Avatar for Anfinsen_slept_here 21. Anfinsen_slept_here Lv 1 17 pts. 41,632
  2. Avatar for georg137 22. georg137 Lv 1 15 pts. 41,626
  3. Avatar for TheGUmmer 23. TheGUmmer Lv 1 14 pts. 41,611
  4. Avatar for Aubade01 24. Aubade01 Lv 1 12 pts. 41,501
  5. Avatar for meatexplosion 25. meatexplosion Lv 1 11 pts. 41,467
  6. Avatar for hookedwarm 26. hookedwarm Lv 1 10 pts. 41,406
  7. Avatar for Dr.Sillem 27. Dr.Sillem Lv 1 9 pts. 41,288
  8. Avatar for alcor29 28. alcor29 Lv 1 8 pts. 41,276
  9. Avatar for vs 29. vs Lv 1 7 pts. 41,213
  10. Avatar for zxspectrum 30. zxspectrum Lv 1 6 pts. 41,116

Comments