Icon representing a puzzle

2641: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since 8 months ago

Novice Overall Prediction

Summary


Created
July 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,994
  2. Avatar for Andrew's Foldit group 12. Andrew's Foldit group 1 pt. 8,943

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 19 pts. 9,596
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 17 pts. 9,591
  3. Avatar for Aubade01 23. Aubade01 Lv 1 15 pts. 9,583
  4. Avatar for montezumasrevenge 24. montezumasrevenge Lv 1 14 pts. 9,571
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 12 pts. 9,549
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 11 pts. 9,547
  7. Avatar for LHOr 27. LHOr Lv 1 10 pts. 9,533
  8. Avatar for alcor29 28. alcor29 Lv 1 9 pts. 9,506
  9. Avatar for taiunplant 29. taiunplant Lv 1 8 pts. 9,498
  10. Avatar for vybi 30. vybi Lv 1 7 pts. 9,482

Comments