Icon representing a puzzle

2641: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
July 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,900
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 9,870
  3. Avatar for Contenders 3. Contenders 37 pts. 9,681
  4. Avatar for Australia 4. Australia 21 pts. 9,679
  5. Avatar for VeFold 5. VeFold 11 pts. 9,662
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 9,658
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,621
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 9,591
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,385
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,342
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 19 pts. 9,596
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 17 pts. 9,591
  3. Avatar for Aubade01 23. Aubade01 Lv 1 15 pts. 9,583
  4. Avatar for montezumasrevenge 24. montezumasrevenge Lv 1 14 pts. 9,571
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 12 pts. 9,549
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 11 pts. 9,547
  7. Avatar for LHOr 27. LHOr Lv 1 10 pts. 9,533
  8. Avatar for alcor29 28. alcor29 Lv 1 9 pts. 9,506
  9. Avatar for taiunplant 29. taiunplant Lv 1 8 pts. 9,498
  10. Avatar for vybi 30. vybi Lv 1 7 pts. 9,482

Comments