Icon representing a puzzle

2641: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since 7 months ago

Novice Overall Prediction

Summary

Created
July 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,900
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 9,870
  3. Avatar for Contenders 3. Contenders 37 pts. 9,681
  4. Avatar for Australia 4. Australia 21 pts. 9,679
  5. Avatar for VeFold 5. VeFold 11 pts. 9,662
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 9,658
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 9,621
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 9,591
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,385
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,342
  1. Avatar for borattt 31. borattt Lv 1 6 pts. 9,476
  2. Avatar for hada 32. hada Lv 1 6 pts. 9,469
  3. Avatar for Alistair69 33. Alistair69 Lv 1 5 pts. 9,463
  4. Avatar for Dr.Sillem 34. Dr.Sillem Lv 1 4 pts. 9,455
  5. Avatar for heather-1 35. heather-1 Lv 1 4 pts. 9,426
  6. Avatar for Oscar JV 36. Oscar JV Lv 1 3 pts. 9,426
  7. Avatar for rosie4loop 37. rosie4loop Lv 1 3 pts. 9,417
  8. Avatar for jamiexq 38. jamiexq Lv 1 3 pts. 9,404
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 2 pts. 9,392
  10. Avatar for johngran 40. johngran Lv 1 2 pts. 9,392

Comments