Icon representing a puzzle

2644: Revisiting Puzzle 144: Rosetta Decoy 8

Closed since 9 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 06, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,310
  2. Avatar for Go Science 2. Go Science 56 pts. 12,133
  3. Avatar for Contenders 3. Contenders 29 pts. 12,082
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 14 pts. 11,940
  5. Avatar for Australia 5. Australia 6 pts. 11,938
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 2 pts. 11,844
  7. Avatar for VeFold 7. VeFold 1 pt. 11,473
  8. Avatar for Team China 8. Team China 1 pt. 10,579
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 1 pt. 10,416
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,345

  1. Avatar for akaaka 11. akaaka Lv 1 49 pts. 11,986
  2. Avatar for meatexplosion 12. meatexplosion Lv 1 45 pts. 11,983
  3. Avatar for Galaxie 13. Galaxie Lv 1 42 pts. 11,944
  4. Avatar for nicobul 14. nicobul Lv 1 39 pts. 11,940
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 36 pts. 11,938
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 33 pts. 11,892
  7. Avatar for g_b 17. g_b Lv 1 30 pts. 11,851
  8. Avatar for WBarme1234 18. WBarme1234 Lv 1 28 pts. 11,844
  9. Avatar for Tehnologik1 19. Tehnologik1 Lv 1 25 pts. 11,798
  10. Avatar for borattt 20. borattt Lv 1 23 pts. 11,755

Comments